PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_002988-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family B3
Protein Properties Length: 524aa    MW: 58700.3 Da    PI: 6.0266
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_002988-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.81.1e-144565212996
                    -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
             B3  29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                    + +e k + l+d+  r+W v +    ++g  vl++GW+ F++an++++gD++vF l+++se+ + v+v
  NNU_002988-RA 456 SRTERKIIFLQDSAMRVWPVLY--HERPGFKVLASGWEAFAEANNIQQGDVCVFGLKNESEGLYQVRV 521
                    334667999*************..********************************998888677776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.139426524IPR003340B3 DNA binding domain
SMARTSM010190.0018429522IPR003340B3 DNA binding domain
CDDcd100171.31E-11434521No hitNo description
PfamPF023625.2E-12436521IPR003340B3 DNA binding domain
SuperFamilySSF1019361.88E-13438521IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-13457514IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MEALGVRNYT YLSSRVGWPV VAGFLPPKFV RELASLVGKK TCLEDSNGER WKIFDKSTCE  60
KLSFSERTNV TTNGTTGKRK RAKSKHPSDG FPTEARKSAP TNGPCKIIDR VSINEQGSSS  120
TVISSDIEII ECDAKDMEKV PVANGNKRPQ DLPKVDCAEV PYYMIDRNSI TEQGESFSLF  180
DLSKFEMLGS TSDCKKSNKI SVNVEKEKCP YGDERSEIPP APLEQGRVDK NPVADESSER  240
PQTLLEEGRF HNDPVADTNR AAPFDGSGFK MSEEKWNAED MPRVPQITES CYQNSPTLPQ  300
TTCLVDLVEN ERGNEILNRA INQGAGKCPE RKSQEEHTPF VGISRSICPI TWTSDHSVTV  360
AGKKLPRVVK EEHVEITKEV HAAKEPKVIK EEFEENAYST LKDQVKVCKM VKTEIVDSID  420
LPSPNLGDFC IPVSTVTQSW LELPRETQPL AYRVRSRTER KIIFLQDSAM RVWPVLYHER  480
PGFKVLASGW EAFAEANNIQ QGDVCVFGLK NESEGLYQVR VAKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248803.10.0PREDICTED: B3 domain-containing protein Os01g0905400-like isoform X1